Fattore di crescita del tipo di insulina umano del DES 1mg dei peptidi IGF-1 di crescita di CAS 946870-92-4 IGF-1 LUNGO

Informazioni di base
Luogo di origine: La Cina
Marca: GSP
Certificazione: ISO9001,SGS,UKAS,GMP
Numero di modello: DES IGF-1
Quantità di ordine minimo: Campioni liberi disponibili
Prezzo: Negotiable
Imballaggi particolari: 10iu/vial, 10vials/kit
Tempi di consegna: 3-6 giorni lavorativi
Termini di pagamento: Western Union, MoneyGram, T/T, Bitcoins
Capacità di alimentazione: 10000-30000iu/month
Alias: IGF-1 R3 lungo Specifiche: 0.1mg, 1mg, 1g
Sinonimi: R3-IGF-1 lungo Imballaggio: Imballaggio discreto per il passaggio della dogana garantito
Aspetto: Polvere liofilizzata bianca CAS: 946870-92-4
Email: tonyraws810@gmail.com WhatsApp: 86-15871352379
Wickr: tonyraws
Evidenziare:

Peptidi della costruzione del muscolo

,

peptidi dell'ormone della crescita

Il ricombinante umano del DES di IGF-I (1-3) prodotto in Escherichia coli è catena non glicosilata e del polipeptide una singola, che contiene 67 aminoacidi (aa 4-70) e che ha una massa molecolare di 7368,5 Dalton.
IGF-1 Des1-3 è purificato mediante tecniche cromatografiche private.

 

Fattore di crescita del tipo di insulina umano del DES 1mg dei peptidi IGF-1 di crescita IGF-1 LUNGO

 

DES del tipo di insulina di crescita Factor-1 (1-3):

 

Sequenza

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK

PAKSA

Sinonimi

Somatomedina C, IGF-I, IGFI, IGF1, IGF-IA, fattore di crescita di Mechano, MGF, DES (1-3), Des1-3,

DES 1-3, DES (1-3), IGF-1 (4-70).

Aspetto fisico Polvere (liofilizzata) liofilizzata bianca filtrata sterile
Solubilità

È raccomandato per ricostituire il DES di IGF-I (1-3) nel 18M-cm sterile H2O non di meno che

100µg/ml, che può poi più ulteriormente essere diluito ad altre soluzioni acquose.

Purezza Più maggior di 97,0% come determinato vicino:
() un'analisi da RP-HPLC.
(b) analisi da SDS-PAGE.
Uso

I prodotti di ProSpec sono forniti per USO della RICERCA del LABORATORIO SOLTANTO. Il prodotto

non possono essere usati come droghe, i prodotti agricoli o antiparassitari, gli additivi alimentari o i prodotti chimici di famiglia.

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Descrizioni:

 

IL DES IGF-1 è la versione abbreviata della catena IGF-1. È cinque (5) volte più potenti di IGF-LR3 e di dieci (10) volte più potenti della base regolare IGF-1. L'emivita per il DES è circa 20-30 minuti, che significa che questa è una catena molto delicata. Di conseguenza, l'amministrazione dovrebbe essere fatta soltanto al sito in cui volete vedere la crescita del muscolo. Il DES ha la capacità di stimolare l'iperplasia del muscolo migliore di LR3. Nei termini semplici, è usato il più bene per le iniezioni del sito, piuttosto che la crescita globale.

 

Inoltre, il DES è conosciuto per legare ai ricevitori che sono stati deformati da acido lattico, che è spesso presente durante gli allenamenti. Ciò permette che il DES si attacchi ad una crescita mutata del tessuto del segnale e del ricevitore durante l'addestramento. Il DES può essere usato più lungamente e più frequentemente di LR3.

 

DES IGF1:

 

L'insulina come il fattore di crescita (IGF) - 1 (4-70), conosciuto altrimenti come DES IGF-1, prodotto in Escherichia coli, è catena non glicosilata e del polipeptide una singola, che contiene 67 aminoacidi e che ha una massa molecolare di 7.372 Da. Gli studi in vitro dimostrano che al DES uguale delle dosi (1-3) IGF è dieci volte più potente di IGF-1 all'ipertrofia di stimolazione e della proliferazione in cellule di cultura. È probabile generato con modifica post-di traduzione nella sequenza di IGF-1 maturo di circolazione via azione della proteasi.

 

IL DES IGF-1 è una forma fenduta di IGF-1 e contiene gli aminoacidi 4-70. Questa struttura ha permesso che gli effetti della proteina IGF-1 fossero amplificati nella forma più stabile del frammento della proteina del peptide della molecola del DES 1,3 del fattore di crescita del tipo di insulina 1. Il DES IGF-1, o il DES del tipo di insulina di fattore di crescita, viene dalla famiglia IGF-1 dei peptidi che svolgono i ruoli importanti nella crescita e sviluppo mammifera. IGF1 media molti degli effetti dipromozione dell'ormone della crescita e del DES IGF-1, sebbene più breve, patti un la quantità uguale di cambiamenti fisici d'alterazione fisiologici della proteina. Gli studi iniziali hanno indicato che l'ormone della crescita direttamente non ha stimolato l'incorporazione di solfato in cartilagine, ma piuttosto hanno agito con un fattore del siero, hanno definito “il fattore di sulfation,” che più successivamente è stato conosciuto più recentemente come “la somatomedina” o IGF-1 e con troncamento, DES IGF-1.

 

Fattore di crescita del tipo di insulina umano del DES 1mg dei peptidi IGF-1 di crescita di CAS 946870-92-4 IGF-1 LUNGO 0

 

Dosaggio:

 

IL DES IGF-1 può essere dosato ai tempi multipli 50-150mcg un il giorno (prima di addestramento) nelle aree di obiettivo specifiche. poiché il DES ha così breve emivita (20-30 minuti), la desensibilizzazione non è stata notata affatto. I siti iniezione dovrebbero essere localizzati; preferibilmente, al gruppo del muscolo volete svilupparti. Nei termini semplici, se volete coltivare il vostro bicipite, inietti la destra del DES IGF-1 nel vostro bicipite.

 

IGF-1 contro HGH:

 

Perché IGF-1 e non GH? L'ormone della crescita realmente è un precursore a IGF-1. L'ormone della crescita direttamente non causa la crescita del muscolo, ma indirettamente causa la crescita del muscolo segnalando il rilascio di IGF-1. L'ormone umano della crescita (HGH) può essere molto costoso e vedere la crescita che del muscolo deve essere accoppiato con insulina o altri steroidi anabolizzanti. Ciò fa le varianti IGF-1 come LR3 ed il DES, che possono essere usati come droga autonoma, un opzione molto più realizzabile per il culturista che guarda per vedere il recupero solido della crescita nociva del muscolo e del tessuto.

 

Grado del ricevitore contro il grado IGF-1 LR3 di media:


Il grado genuino LR3 IGF-I del ricevitore è un reagente della ricerca di alta qualità per uso negli studi sulla crescita delle cellule, sui ricevitori di IGF e sulle proteine leganti di IGF ed è più potente del rH IGF-1 e del grado IGF-1 LR3 di media sia in vivo che in vitro dovuto l'aumento drastico nell'attività biologica (più forte affinità per legare con il ricevitore di IGF) e nella purezza ad alto livello. Questa combinazione di attività biologica e di purezza aumentate è che cosa mette il grado IGF-1 LR3 del ricevitore oltre a IGF-1 standard. Il grado LR3 IGF-I di media è utilizzato più comunemente nella coltura cellulare commerciale contro mammifero. Può anche essere usato come reagente della ricerca ad un costo economico per permettere agli studi dove la potenza biologica è meno utile e le più alte quantità sono richieste. Per massimizzare i risultati ad un in un grado basato a animale IGF-1 R3 lungo del ricevitore di studio o di produzione delle cellule dovrebbe essere usata esclusivamente.

 

Avete di politica di reshipment?

 

Facciamo il buoni servizio di dopo-vendita e politica della ri-spedizione perdere se il pacchetto.
La nostra associazione lunga con i nostri clienti ha portato i notevoli benefici.
Prendiamo sempre la cura upmost nell'imballaggio dei nostri prodotti.
I nostri clienti confermeranno questo anche che lottano per trovarli a volte senza aiuto.
Ma malgrado i nostri migliori sforzi che sia ancora possibile afferrerà un piccolo numero di pacchetti.
In questa circostanza promettiamo il reship libero di stabilire la relazione a lungo termine.

 

Trasporto:

 

1. Preferenziale DHL o HKEMS per la quantità più di meno di 50KG;
2. trasporto del mare per la quantità sopra 60KG. 100% sicuro!
3. invii dal nostro agente nei Paesi Bassi, Singapore, Laos, U.S.A.

 

Tutti i bisogni, mi contattano prego

Email: tonyraws810@gmail.com

Whatsapp: 86-15871352379

Wickr: tonyraws

Dettagli di contatto
Sales Manager

Numero di telefono : +8613657291547

WhatsApp : +https://api.whatsapp.com/send?phone=8615871352379